PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G142200.1.p
Common NameGLYMA_20G142200, LOC100793758
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 732aa    MW: 80362.1 Da    PI: 6.6104
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G142200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.8e-1948103156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rr+ t++t++q+ e+e++F+ +++p++++r+ L ++lgL+  q+k+WFqN+R++ k
  Glyma.20G142200.1.p  48 RRRHTRHTHHQISEMESFFKGCPHPDEKQRKALGRELGLEPLQIKFWFQNKRTQVK 103
                          7999************************************************9877 PP

2START165.24.8e-522564706206
                          HHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
                START   6 aaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                          a +e +++ l+++p+Wv      e  n+de+l+ f+++ +      ++e +r +++v+m +++lve l+d++ qW++++     +a t+e
  Glyma.20G142200.1.p 256 AIEEINRLSLSGDPLWVPGNygsEVVNEDEYLRVFPRGIGptllgARTESSRQTAIVIMHHMKLVEMLMDVN-QWSNMFCgivsRAVTHE 344
                          567788889999*****988888889***********999********************************.******999******** PP

                          EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
                START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                          v+s+g      ga q+m+ae+q++splvp Rd +f+R+++++++ +w++vd S d+ ++        + +++pSg++i++++ng+skv+w
  Glyma.20G142200.1.p 345 VLSTGetirydGACQVMSAEFQVPSPLVPtRDNYFIRFCKKHQGQSWAVVDFSMDHLRPGAI----TKIRRRPSGCIIQELPNGYSKVIW 430
                          ***********************************************************985....44448******************* PP

                          EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          vehv+++++ +h+l++ lv s+la+gak+wva+ +r ce+
  Glyma.20G142200.1.p 431 VEHVEVDDSEVHNLYKNLVDSTLAFGAKRWVAAIDRTCER 470
                          **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-193399IPR009057Homeodomain-like
SuperFamilySSF466896.27E-1843111IPR009057Homeodomain-like
PROSITE profilePS5007116.24445105IPR001356Homeobox domain
SMARTSM003893.8E-1747109IPR001356Homeobox domain
PfamPF000461.7E-1648103IPR001356Homeobox domain
CDDcd000863.04E-1358106No hitNo description
PROSITE profilePS5084834.331242473IPR002913START domain
CDDcd088758.59E-96246469No hitNo description
SMARTSM002342.6E-42251470IPR002913START domain
PfamPF018521.2E-43257470IPR002913START domain
SuperFamilySSF559616.87E-26305472No hitNo description
Gene3DG3DSA:3.30.530.202.3E-4354464IPR023393START-like domain
SuperFamilySSF559612.88E-21491722No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MEMSLQRTSS ENNSGRNREE QEPSNKETTM EAPASGDDDQ DLEEGFKRRR HTRHTHHQIS  60
EMESFFKGCP HPDEKQRKAL GRELGLEPLQ IKFWFQNKRT QVKTQQERYE NNLLRVENDK  120
LRAENRRYRN ALANALCPSC GGPTALGEMS FDEQQLRIEN ARLKEEIASM SGPAAKHAGK  180
SGSNSYCNMP SQNQMPSRSL DLGVGNNNKN NNFVAVAQAQ PAAMVGEIYG GNDPLRELPL  240
FSCFDKTLIG EIGLVAIEEI NRLSLSGDPL WVPGNYGSEV VNEDEYLRVF PRGIGPTLLG  300
ARTESSRQTA IVIMHHMKLV EMLMDVNQWS NMFCGIVSRA VTHEVLSTGE TIRYDGACQV  360
MSAEFQVPSP LVPTRDNYFI RFCKKHQGQS WAVVDFSMDH LRPGAITKIR RRPSGCIIQE  420
LPNGYSKVIW VEHVEVDDSE VHNLYKNLVD STLAFGAKRW VAAIDRTCER LASAMATNIP  480
QGALCVITSH ESRKSMMKLA ERMVLSFCTG VGASTANAWT PLPSGLEDVR VMTRKSVDDP  540
GRPPGIVLSA ATSLWLPVPA RRVFEFLRSE NTRNQWDILS TGAQVNELAH IANGRDHGNC  600
VSLLRVNTQN VGQNNMLILQ ESFIDATGSF VIYAPIDVAA INVVLGGGNP DYVALLPSGF  660
AVLPDGPGLN GGPGPICEAG SGGGCLLTVA FQILVDSAPT SKISVGSVTT VNSLIKRTVE  720
KIRDAVSLDG N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555330.20.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X2
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLI1NGA80.0I1NGA8_SOYBN; Uncharacterized protein
STRINGGLYMA20G28010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2237224
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein